Protein coding transcript 698

• Transcript: Ll_transcript_389432
• CDS coordinates: 243-713 (+)
• Peptide sequence: MGLPTNGTTGENQLKFLIYGRTGWIGGLLGKLCEAQGISYVYGTGRLQNRSSLEADIAEVKPSHVFNAAGVTGRPNVDWCESHKVETITTNVVGTLTLADVCRTKGIILINYATGCIFEYDSLHTLGSGVGFKEEDTPNFIGSFYSKTKAMVIIPI*
• ORF Type: complete

Annotations of Ll_transcript_389432

• Blastp: Bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose reductase from Arabidopsis with 85.82% of identity
• Blastx: Bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose reductase from Arabidopsis with 86.09% of identity
• Eggnog: dTDP-glucose 4-6-dehydratase(COG1088)
• Kegg: Link to kegg annotations (AT1G63000)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421934.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;