| Transcript | Ll_transcript_466182 |
|---|---|
| CDS coordinates | 2-304 (+) |
| Peptide sequence | PGSKEPQLWNDIWKFFEKASVLEFEESKMHKTYETISFREVHDEIVELKGLTDRLNSPVIFSHNDLLSANIMINDDEDKIYFIDYEYASYNYRGFDIANHF |
| ORF Type | internal |
| Blastp | Probable ethanolamine kinase from Arabidopsis with 67.33% of identity |
|---|---|
| Blastx | Probable ethanolamine kinase from Arabidopsis with 67.33% of identity |
| Eggnog | Ethanolamine kinase(COG0510) |
| Kegg | Link to kegg annotations (AT2G26830) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019415990.1) |
| Pfam | Choline/ethanolamine kinase (PF01633.19) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer