Transcript | Ll_transcript_468359 |
---|---|
CDS coordinates | 2-397 (+) |
Peptide sequence | ATNIILNAAVIRPLGYYLHMQTHVFNRPATITRPIIFCTAILSLYFLVVALFKDIPDTEGDKKFGVQSLSVRLGQKRVFSICISLLQMAYGASILAGATSPFLWSKVITVICYLHVKASTNVCEYNYPFLC* |
ORF Type | 5prime_partial |
Blastp | Naringenin 8-dimethylallyltransferase 2, chloroplastic from Sophora with 69.37% of identity |
---|---|
Blastx | Naringenin 8-dimethylallyltransferase 2, chloroplastic from Sophora with 69.37% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419927.1) |
Pfam | UbiA prenyltransferase family (PF01040.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer