Transcript | Ll_transcript_465825 |
---|---|
CDS coordinates | 365-1216 (+) |
Peptide sequence | MGNVNEREQVFNVNVASEVQQSHEGEEECEIVSPSQLLMMMGQVPSPSPRVTHSPFMFTPQVPVVPLQRPDEMHVPSPPWMQTRSGCEDMFRELGIPTMITWSYEGKEVAVEGSWDNWKTRIPLQRSGKDFTIIKVLPSGVYQFRFIVDGQWRYAPDLPWALDEAGNAYNTLDLQDFVPEDIGSISSFEPPKSPESSYNNSQLSSEDYAKDPPLVPPYSQMTLLNVPSTNMEIQPPISKPQHVMLNHLYMQKEKGSPSVVALGTTHRFLAKYVTVVLYKSLQR* |
ORF Type | complete |
Blastp | SNF1-related protein kinase regulatory subunit beta-2 from Arabidopsis with 64.75% of identity |
---|---|
Blastx | SNF1-related protein kinase regulatory subunit beta-2 from Arabidopsis with 64.75% of identity |
Eggnog | Protein kinase, AMP-activated, beta(ENOG410XRB3) |
Kegg | Link to kegg annotations (AT4G16360) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419185.1) |
Pfam | Glycogen recognition site of AMP-activated protein kinase (PF16561.4) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer