Protein coding transcript 6993

• Transcript: Ll_transcript_527700
• CDS coordinates: 153-710 (+)
• Peptide sequence: MVMWVFGYGSLIWKAGFHFDERVVGFIKGYRRVFYQGSTDHRGTPEYPGRTVTLEPAEGEICWGAAYKISKKEDEEIAITYLEVREKQYDKKEYLDLFTDLTATTPAISGVMVYIASPNKKDNVNYLGPASVEDIARQIVHAEGPSGPNRDYLFQLEKALVQIGCKDKHVIDLANEVRRILSEEH*
• ORF Type: complete

Annotations of Ll_transcript_527700

• Blastp: Gamma-glutamylcyclotransferase 2-3 from Arabidopsis with 74.32% of identity
• Blastx: Gamma-glutamylcyclotransferase 2-3 from Arabidopsis with 74.32% of identity
• Eggnog: cation transport(COG3703)
• Kegg: Link to kegg annotations (AT1G44790)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459338.1)
• Pfam: ChaC-like protein (PF04752.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;