Protein coding transcript 7

• Transcript: Ll_transcript_534381
• CDS coordinates: 2-322 (+)
• Peptide sequence: FELPFALIPLLKFSGSSTKMGPHKNSMIIIVFSWILGFGIIGINVYYLITAFTGWIIHSSLSKVAIVFIGIMVSLLMIVYIGSILYLTFRKDTVETFIEIEEDPGKQ
• ORF Type: internal

Annotations of Ll_transcript_534381

• Blastp: Metal transporter Nramp5 from Oryza sativa with 64.29% of identity
• Blastx: Metal transporter Nramp5 from Oryza sativa with 64.29% of identity
• Eggnog: H( )-stimulated, divalent metal cation uptake system (By similarity)(COG1914)
• Kegg: Link to kegg annotations (4342859)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004502502.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;