Transcript | Ll_transcript_504586 |
---|---|
CDS coordinates | 2-331 (+) |
Peptide sequence | FFLCFQFTLKSGCCKPSNDCGFTYISPTNWTKTEKGVPANPDCNAWNNDPNILCYNCQSCKAGFLQNIKKSWKKVSIANIILLIFLTVVYSIGCLAFRNNRNGDYYNKY* |
ORF Type | 5prime_partial |
Blastp | Tetraspanin-7 from Arabidopsis with 65.96% of identity |
---|---|
Blastx | Tetraspanin-7 from Arabidopsis with 65.96% of identity |
Eggnog | Tetraspanin family(ENOG4110562) |
Kegg | Link to kegg annotations (AT4G28050) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463182.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer