Protein coding transcript 700

• Transcript: Ll_transcript_504586
• CDS coordinates: 2-331 (+)
• Peptide sequence: FFLCFQFTLKSGCCKPSNDCGFTYISPTNWTKTEKGVPANPDCNAWNNDPNILCYNCQSCKAGFLQNIKKSWKKVSIANIILLIFLTVVYSIGCLAFRNNRNGDYYNKY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_504586

• Blastp: Tetraspanin-7 from Arabidopsis with 65.96% of identity
• Blastx: Tetraspanin-7 from Arabidopsis with 65.96% of identity
• Eggnog: Tetraspanin family(ENOG4110562)
• Kegg: Link to kegg annotations (AT4G28050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463182.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;