| Transcript | Ll_transcript_465762 |
|---|---|
| CDS coordinates | 364-681 (+) |
| Peptide sequence | MKMKKVCASGVGGYSIMVVVVVAAALLLVEVSPFAEAVTCSPVELSPCLGSITSSSPPSSTCCQKLREQRPCLCGYIKNPNLGQYVNSPGARRVASTCGVPYPTC* |
| ORF Type | complete |
| Blastp | Probable non-specific lipid-transfer protein AKCS9 from Vigna with 66.25% of identity |
|---|---|
| Blastx | Non-specific lipid-transfer protein 2 from Prunus with 75% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019442511.1) |
| Pfam | Probable lipid transfer (PF14368.5) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer