Transcript | Ll_transcript_465770 |
---|---|
CDS coordinates | 364-681 (+) |
Peptide sequence | MKMKKVCASGVGGYSIMVVVVVAAALLLVEVSPFAEAVTCSPVELSPCLGSITSSSPPSSTCCQKLREQRPCLCGYIKNPNLGQYVNSPGARRVASTCGVPYPTC* |
ORF Type | complete |
Blastp | Probable non-specific lipid-transfer protein AKCS9 from Vigna with 66.25% of identity |
---|---|
Blastx | Non-specific lipid-transfer protein 2 from Prunus with 75.76% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442511.1) |
Pfam | Probable lipid transfer (PF14368.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer