Protein coding transcript 70165

• Transcript: Ll_transcript_468146
• CDS coordinates: 159-506 (+)
• Peptide sequence: MSSADPEHRDDDEAPAAGDDEDTGAQVAPIVRLDEVAVTTGEEDEDAILDLKSKLYRFDKDGNQWKERGAGTVKFLKHKVTGNVRLLMRQSKTLKICSNHLRTDDDLPPSHKNRF*
• ORF Type: complete

Annotations of Ll_transcript_468146

• Blastp: Ran-binding protein 1 homolog a from Arabidopsis with 79.61% of identity
• Blastx: Ran-binding protein 1 homolog c from Arabidopsis with 76.24% of identity
• Eggnog: ran binding protein(COG5171)
• Kegg: Link to kegg annotations (AT1G07140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003556169.1)
• Pfam: RanBP1 domain (PF00638.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;