Protein coding transcript 70166

• Transcript: Ll_transcript_468149
• CDS coordinates: 211-570 (+)
• Peptide sequence: MTVQEHAGNEKSCVWHARDFADGELKDELFCIRFQSIENAKKFIESFQEVAESQNPAEESKDASAAAGLLENLSVEGNNDADKKDEEKSDNKTAEEESSSGKESKADTEKKSEEPASSA*
• ORF Type: complete

Annotations of Ll_transcript_468149

• Blastp: Ran-binding protein 1 homolog c from Arabidopsis with 70.51% of identity
• Blastx: Ran-binding protein 1 homolog c from Arabidopsis with 74.24% of identity
• Eggnog: ran binding protein(COG5171)
• Kegg: Link to kegg annotations (AT5G58590)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413072.1)
• Pfam: RanBP1 domain (PF00638.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;