Protein coding transcript 702

• Transcript: Ll_transcript_504583
• CDS coordinates: 1251-1607 (+)
• Peptide sequence: MLIFENKGSNVATLCGEILARSSSISEGIQKEQVVAVRSSTPNSPIIRWFPPDDGWVKLNLDGAYSVSSKKAACGRVVRDPLGAFVFAYAKYLGHCSALHAELWGILIGLQLLGQRGF*
• ORF Type: complete

Annotations of Ll_transcript_504583

• Blastp: Putative ribonuclease H protein At1g65750 from Arabidopsis with 34.86% of identity
• Blastx: Putative ribonuclease H protein At1g65750 from Arabidopsis with 27.57% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016164673.1)
• Pfam: Reverse transcriptase-like (PF13456.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;