Protein coding transcript 70214

• Transcript: Ll_transcript_467921
• CDS coordinates: 398-1003 (+)
• Peptide sequence: MKANWTAFDDYCRNRGLKYPFMVKRLACMVISGVSKSDSLDILQPANLTSDMILEMEEEFALLRNAFSKTSIADEHIAFLTKQWYISVLARIRINAFRIELVGGLYEDLLSSLVASVEAEAAVGNAVYILPSLYNHDCDPNAHIIWIDNADAKIKALCDIDEGEELRICYIDASMDRDARQELLFQGFGFQCNCSRCLQGD*
• ORF Type: complete

Annotations of Ll_transcript_467921

• Blastp: Histone-lysine N-methyltransferase ATXR4 from Arabidopsis with 65.17% of identity
• Blastx: Histone-lysine N-methyltransferase ATXR4 from Arabidopsis with 64.73% of identity
• Eggnog: Histone-lysine N-methyltransferase(COG2940)
• Kegg: Link to kegg annotations (AT5G06620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442963.1)
• Pfam: SET domain (PF00856.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;