Protein coding transcript 70223

• Transcript: Ll_transcript_467925
• CDS coordinates: 3-368 (+)
• Peptide sequence: QITGLAKQMVTTFGMSDIGPWSLMDTSAQSGDVFMRMMARNSMSEKLAKDIDAAIKRLSDEAYEIALRHIKNNREAIDKIVEVLLEKETMSGDEFRTLLSEFAEIPAENQVPPSTPSPVAV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_467925

• Blastp: ATP-dependent zinc metalloprotease FTSH 2, chloroplastic from Oryza sativa with 83.78% of identity
• Blastx: ATP-dependent zinc metalloprotease FTSH 2, chloroplastic from Oryza sativa with 83.64% of identity
• Eggnog: Acts as a processive, ATP-dependent zinc metallopeptidase for both cytoplasmic and membrane proteins. Plays a role in the quality control of integral membrane proteins (By similarity)(COG0465)
• Kegg: Link to kegg annotations (4341796)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418270.1)
• Pfam: Peptidase family M41 (PF01434.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;