Protein coding transcript 70271

• Transcript: Ll_transcript_484532
• CDS coordinates: 138-638 (+)
• Peptide sequence: MAATVASRCSHLGRSLFGGLRNSVPGLLTTSHELTCSNFLSQQQRTFIQMRTVLKVVDNSGAKKVMCIQALKGKKGARLGDTIIASVKEAHPNGKVKKGKVVYGVVVRAAMQKGRCDGSEVKFDDNAVVLVDKQGQPIGTRVFGPVPHELRQKKHVKILTLAGHIA*
• ORF Type: complete

Annotations of Ll_transcript_484532

• Blastp: 50S ribosomal protein HLP, mitochondrial from Arabidopsis with 73.14% of identity
• Blastx: 50S ribosomal protein HLP, mitochondrial from Arabidopsis with 73.14% of identity
• Eggnog: Binds to 23S rRNA. Forms part of two intersubunit bridges in the 70S ribosome (By similarity)(COG0093)
• Kegg: Link to kegg annotations (AT5G46160)
• CantataDB: Link to cantataDB annotations (CNT0002621)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454511.1)
• Pfam: Ribosomal protein L14p/L23e (PF00238.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;