Protein coding transcript 70287

• Transcript: Ll_transcript_482508
• CDS coordinates: 35-1186 (+)
• Peptide sequence: MMTLVQILLVGLMVFLLHVINVLVLKPRSLRAKLHRQGIKGPTPHFFFGNNHEIKRLHAIAATNQDKENDGFISHNWPSKMFPYIEKWRKQYGDMFLFSTGTIQSLMVTDIEMVKKIILYTALNLGKPSYLAKYMKPFLGLGILSSSGPTWQLHRKIIAPQLYLDKVKAMINLMVDSTNIIIRSWEAKIERDGGVSEIKVDHDLQNLSADIIAKACFGRNFNEAKEIFTKLRDIQRAMSSVFAYVGIPGFRYLPIKTNREIWRIEKEIDTLILKFIKERLDHGEEKDLLQMILVGANNHEENDKYFKNSVARDRFIIDNCKNIFTAGHETAAITASWCLMLLATHQDWQDRVRAEVLQLCGSDPPNATMLRRMDTVCFIYNVN*
• ORF Type: complete

Annotations of Ll_transcript_482508

• Blastp: Cytochrome P450 714C2 from Oryza sativa with 41.93% of identity
• Blastx: Cytochrome P450 714C2 from Oryza sativa with 42.27% of identity
• Eggnog: Cytochrome p450(COG2124)
• Kegg: Link to kegg annotations (4351346)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464424.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;