Protein coding transcript 703

• Transcript: Ll_transcript_504557
• CDS coordinates: 1-300 (+)
• Peptide sequence: GTFADMLDPAVEEWPVEHAMHFAKLALQCAEMRRKDRPDLGKVVLPELNKLRDFAEENLPMMMMFGAGFATRTNNYMRSPISSSTAQDDSQLSGYESRST
• ORF Type: internal

Annotations of Ll_transcript_504557

• Blastp: U-box domain-containing protein 51 from Arabidopsis with 47.27% of identity
• Blastx: U-box domain-containing protein 51 from Arabidopsis with 47.27% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G61560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447241.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;