Transcript | Ll_transcript_482862 |
---|---|
CDS coordinates | 2-568 (+) |
Peptide sequence | MNTAMIFLTCQKDPASLGFVLLHYIYVCDLQLVHLSSVFLLFAHFIFGRPQYRKKVDSSPVIEHSNSFSKPSFRKAPSHSYSMKNNITELKSLELFDCLFKECKNVGVKMVSEGLITRKDIEEVRSGKGNRIISIGLPAYCLLQGLLRSAKVNSVGLLISDDTELTSSNRPREVFFEWFLNPLLIMKEQ |
ORF Type | 3prime_partial |
Blastp | Uncharacterized membrane protein At3g27390 from Arabidopsis with 49.33% of identity |
---|---|
Blastx | Uncharacterized membrane protein At3g27390 from Arabidopsis with 49.33% of identity |
Eggnog | NA(ENOG410Y9F4) |
Kegg | Link to kegg annotations (AT3G27390) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458169.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer