Protein coding transcript 70329

• Transcript: Ll_transcript_482862
• CDS coordinates: 2-568 (+)
• Peptide sequence: MNTAMIFLTCQKDPASLGFVLLHYIYVCDLQLVHLSSVFLLFAHFIFGRPQYRKKVDSSPVIEHSNSFSKPSFRKAPSHSYSMKNNITELKSLELFDCLFKECKNVGVKMVSEGLITRKDIEEVRSGKGNRIISIGLPAYCLLQGLLRSAKVNSVGLLISDDTELTSSNRPREVFFEWFLNPLLIMKEQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_482862

• Blastp: Uncharacterized membrane protein At3g27390 from Arabidopsis with 49.33% of identity
• Blastx: Uncharacterized membrane protein At3g27390 from Arabidopsis with 49.33% of identity
• Eggnog: NA(ENOG410Y9F4)
• Kegg: Link to kegg annotations (AT3G27390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458169.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;