| Transcript | Ll_transcript_504563 |
|---|---|
| CDS coordinates | 2-310 (+) |
| Peptide sequence | NNQTAQAQADVIGWTGGKGVPTYKDYVVYVQDSAGEDQLWLALHPAPDSKPEFYDALLNGVEIFKLNDTNLSGPNPQPSDMMVEHEVKERKFEDKETHYNKTF |
| ORF Type | internal |
| Blastp | Receptor-like protein kinase ANXUR1 from Arabidopsis with 50% of identity |
|---|---|
| Blastx | Receptor-like protein kinase ANXUR1 from Arabidopsis with 50% of identity |
| Eggnog | Serine Threonine protein kinase(COG0515) |
| Kegg | Link to kegg annotations (AT3G04690) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019451351.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer