| Transcript | Ll_transcript_485090 |
|---|---|
| CDS coordinates | 2-415 (+) |
| Peptide sequence | SSSFDTNIKVCVMLDINLFREEKGHDPEIIRNSQRTRFSTVQVVDDVINLDKQWRTRQFELENLKRDFNKINKEISKLKRGGEDASKFIGESEETKKLIAQKEVEVRETFTLLNSKLETIGNLVHHSVPISDDEELM* |
| ORF Type | 5prime_partial |
| Blastp | Serine--tRNA ligase from Helianthus with 62.3% of identity |
|---|---|
| Blastx | Serine--tRNA ligase from Helianthus with 89.88% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019452252.1) |
| Pfam | Seryl-tRNA synthetase N-terminal domain (PF02403.21) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer