Transcript | Ll_transcript_485098 |
---|---|
CDS coordinates | 746-1486 (+) |
Peptide sequence | MRKDIMSKCAQLAQFDEELYKVTGEGDDKYLIATAEQPLCAYHIDDWIHPTRLPIRYAGYSSCFRKEAGSHGRDTLGIFRVHQFEKVEQFCLTSPNDNDSWDMHEEMLKNSEEFYQALNIPYQVVSIVSGALNDAAAKKYDLEAWFPSSKAYRELVSCSNCTDYQARRLQVRYGQKKSNDQVKQYVHMLNSTLTATERTICCILENYQKEDGVEIPEVLKPFMGGKTFLPFKNQPVNEAKWKKSKA* |
ORF Type | complete |
Blastp | Serine--tRNA ligase, cytoplasmic from Arabidopsis with 85.43% of identity |
---|---|
Blastx | Serine--tRNA ligase, cytoplasmic from Arabidopsis with 68.85% of identity |
Eggnog | Catalyzes the attachment of serine to tRNA(Ser). Is also able to aminoacylate tRNA(Sec) with serine, to form the misacylated tRNA L-seryl-tRNA(Sec), which will be further converted into selenocysteinyl-tRNA(Sec) (By similarity)(COG0172) |
Kegg | Link to kegg annotations (AT5G27470) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452252.1) |
Pfam | tRNA synthetase class II core domain (G, H, P, S and T) (PF00587.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer