Protein coding transcript 70464

• Transcript: Ll_transcript_485099
• CDS coordinates: 272-1231 (+)
• Peptide sequence: MLDINIFREEKGHDPETIRNSQRSRFASVEVVDDVINLDKEWRKRQFEMENLKRDFNKINKEISKLKRAGEDASKFIIESEETKKLIAEKEVEVRETLSLLNSKLETIGNLVHHSVPVSDDEANNKVVKSWGEKRVEPELKNHVDLVELLGIADTKKGADIAGGRGFYLIGDGVRLNQALINFGLDFLEKRGYTLLHTPFFMRKDIMSKCAQLAQFDEELYKVTGEGDDKYLIATSEQPLCAYHLDDWIHPTQLPIRYAGYSSCFRKEAGSHGRDTLGIFRVHQFEKVEQFCLTSPNDNDSWDMHEEMLKNSEEFYQAV*
• ORF Type: complete

Annotations of Ll_transcript_485099

• Blastp: Serine--tRNA ligase from Helianthus with 76.49% of identity
• Blastx: Serine--tRNA ligase from Helianthus with 76.49% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441157.1)
• Pfam: Seryl-tRNA synthetase N-terminal domain (PF02403.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;