Protein coding transcript 70466

• Transcript: Ll_transcript_485101
• CDS coordinates: 770-1510 (+)
• Peptide sequence: MRKDIMSKCAQLAQFDEELYKVTGEGDDKYLIATAEQPLCAYHIDDWIHPTRLPIRYAGYSSCFRKEAGSHGRDTLGIFRVHQFEKVEQFCLTSPNDNDSWDMHEEMLKNSEEFYQALNIPYQVVSIVSGALNDAAAKKYDLEAWFPSSKAYRELVSCSNCTDYQARRLQVRYGQKKSNDQVKQYVHMLNSTLTATERTICCILENYQKEDGVEIPEVLKPFMGGKTFLPFKNQPVNEAKWKKSKA*
• ORF Type: complete

Annotations of Ll_transcript_485101

• Blastp: Serine--tRNA ligase, cytoplasmic from Arabidopsis with 85.43% of identity
• Blastx: Serine--tRNA ligase, cytoplasmic from Arabidopsis with 68.83% of identity
• Eggnog: Catalyzes the attachment of serine to tRNA(Ser). Is also able to aminoacylate tRNA(Sec) with serine, to form the misacylated tRNA L-seryl-tRNA(Sec), which will be further converted into selenocysteinyl-tRNA(Sec) (By similarity)(COG0172)
• Kegg: Link to kegg annotations (AT5G27470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452252.1)
• Pfam: tRNA synthetase class II core domain (G, H, P, S and T) (PF00587.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;