Protein coding transcript 70470

• Transcript: Ll_transcript_485077
• CDS coordinates: 670-1095 (+)
• Peptide sequence: MRKDIMSKCAQLAQFDEELYKVTGEGDDKYLIATAEQPLCAYHIDDWIHPTRLPIRYAGYSSCFRKEAGSHGRDTLGIFRVHQFEKVEQFCLTSPNDNDSWDMHEEMLKNSEEFYQAVWCFPSFSNLNIIYTILYICSNFK*
• ORF Type: complete

Annotations of Ll_transcript_485077

• Blastp: Serine--tRNA ligase from Helianthus with 79.86% of identity
• Blastx: Serine--tRNA ligase from Helianthus with 75.74% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452252.1)
• Pfam: tRNA synthetase class II core domain (G, H, P, S and T) (PF00587.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;