Protein coding transcript 70495

• Transcript: Ll_transcript_484239
• CDS coordinates: 209-790 (+)
• Peptide sequence: MVLVYSVGHISGAHFNPAVTIAFATTRRFPWKQVPAYVATQVLGSTLASGTLRLIFSGKENQFPGTIPAGSNLQAFVIEFIITFYLMFIISGVATDDRAISELGGIAVGSTVLLNVMIVGPITGASMNPARSIGPAFVHSEYRGIWVYLISPILGAIAGAWVYNIIRYTDKPLSEITKSVSFLKKARPEAESN*
• ORF Type: complete

Annotations of Ll_transcript_484239

• Blastp: Nodulin-26 from Soja with 75.96% of identity
• Blastx: Nodulin-26 from Soja with 75% of identity
• Eggnog: Channel that permits osmotically driven movement of water in both directions. It is involved in the osmoregulation and in the maintenance of cell turgor during volume expansion in rapidly growing cells. It mediates rapid entry or exit of water in response to abrupt changes in osmolarity (By similarity)(COG0580)
• Kegg: Link to kegg annotations (547904)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003629863.1)
• Pfam: Major intrinsic protein (PF00230.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;