Protein coding transcript 70704

• Transcript: Ll_transcript_484868
• CDS coordinates: 266-958 (+)
• Peptide sequence: MHRSGATMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGPALYGGGFDFLTAFVVLILFHSLLVMLLWSYFSAVFTDPGSVPPNWKPALDEERGDTDPLVASEFNNGVPSDPSSQRIRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTASLLPQFLAFFGDGEIPGTPGSLATTFIAFGMESKHNSSCWCRL*
• ORF Type: complete

Annotations of Ll_transcript_484868

• Blastp: Probable protein S-acyltransferase 14 from Arabidopsis with 80.73% of identity
• Blastx: Probable protein S-acyltransferase 14 from Arabidopsis with 80.73% of identity
• Eggnog: Zinc finger, DHHC-type containing(COG5273)
• Kegg: Link to kegg annotations (AT3G60800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433651.1)
• Pfam: DHHC palmitoyltransferase (PF01529.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;