Protein coding transcript 70706

• Transcript: Ll_transcript_484870
• CDS coordinates: 339-890 (+)
• Peptide sequence: MHRSGATMAWNVFKFCTALRGLGSIMILLVLGVVGVTYYAVVLTNYGPALYAGGLDFLSAFAVLILFHSLLVMLLWSYFSVVFTDAGSVPPNWKPAVDEERGEVDPLVGSDFNNVVPSDPSNQHIRFCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFSTFLETTL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_484870

• Blastp: Probable protein S-acyltransferase 14 from Arabidopsis with 82.7% of identity
• Blastx: Probable protein S-acyltransferase 14 from Arabidopsis with 81.76% of identity
• Eggnog: Zinc finger, DHHC-type containing(COG5273)
• Kegg: Link to kegg annotations (AT3G60800)
• CantataDB: Link to cantataDB annotations (CNT0001582)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443846.1)
• Pfam: DHHC palmitoyltransferase (PF01529.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;