Protein coding transcript 70728

• Transcript: Ll_transcript_482974
• CDS coordinates: 397-1005 (+)
• Peptide sequence: MKGSREANKCIVGHSKTELPIFTLCIAITSFLCPFSCRDIQLEYGKHVMKLGITLFELLSEALGLHPNHLKGMGCAEGLITLGHYYPSCPEPELTMGTTKHSDNDFLTVLLQDHIGGLQVLYQDQWIDVPHAPGALVVNIGDLLQASLCLSSSTHTHIYLCVSVLNYGCGYYDCGHYGRCDADYARCGVNYFVSKNIFFTSM*
• ORF Type: complete

Annotations of Ll_transcript_482974

• Blastp: Deacetoxyvindoline 4-hydroxylase from Catharanthus with 69.64% of identity
• Blastx: Deacetoxyvindoline 4-hydroxylase from Catharanthus with 69.64% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AAB97311)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432348.1)
• Pfam: 2OG-Fe(II) oxygenase superfamily (PF03171.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;