Transcript | Ll_transcript_482988 |
---|---|
CDS coordinates | 1-696 (+) |
Peptide sequence | IFFIKYIYNSQSISFDLFCLFPLGSIPYFSKVEHSKHLLSRVILLEYGEHVMELGIALFELLSEALGLHPDHLKNMGCAKGLMTLGHYYPACPEPELTMGTTKHSDNDFLTVLLQDHIGGLQVLYQDKWIDIPPAPGALVVNIGDLLQLITNDRFKSVEHKVLANFIGPRISVACFFSTDLQSFPKLYGPIKELLSEDNPPKYRETTVAEYAKYYKAKGLDGTSALQHFKI* |
ORF Type | 5prime_partial |
Blastp | 1-aminocyclopropane-1-carboxylate oxidase homolog 1 from Arabidopsis with 68.25% of identity |
---|---|
Blastx | 1-aminocyclopropane-1-carboxylate oxidase homolog 1 from Arabidopsis with 68.25% of identity |
Eggnog | 2OGFe(II) oxygenase(COG3491) |
Kegg | Link to kegg annotations (AT1G06620) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432349.1) |
Pfam | 2OG-Fe(II) oxygenase superfamily (PF03171.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer