Protein coding transcript 70743

• Transcript: Ll_transcript_483703
• CDS coordinates: 813-2507 (+)
• Peptide sequence: MCIVHFICSYFMSCPNVIADKCDKIVESLYSKSKNQHLLQSLSGEESPVLGNGNINEELDLRIASVLQSTGHRYDGALWKNHAKRDLSGNERHFAVVTTASLPWMTGTAINPLFRAAYLSKSEKQKVTLLIPWLCTSDQEIVYPTNLSFNSPQEQELYIRNWLEERIGFRTDFKISFYPGKFSKEKRSIIPAGDTSQFIPFKDADIAILEEPEHLNWYHHGMRWTDKFNHVVGIVHTNYLEYIKREKHGPLQAFLVKHINNWVTRAYCHKVLRLSAATQDTPKSVICNVHGVNPKFFKIGKKVASDRELGQETFTKGAYFLGKMVWAKGYKELIDLLANHKSDLEGFNLDVFGSGEDANEVQNMAKRLDLNLNFQRGRDHADDSLHGYKVFINPSLSDVLCTATAEALAMGKFVVCADHPSNEFFRSFPNCLTYKTSNEFVAKVKEALENEPHLLTPAQSYQLSWEAATQRFMEYSELDKIMNKEKDAAKSSTDNRKLIAKSVSMHNLTELVDGGLAFAHFCLTGNNFLRVCTGAIPGTRDYDQQHSKDLNLLPPLVENPIYGW*
• ORF Type: complete

Annotations of Ll_transcript_483703

• Blastp: Digalactosyldiacylglycerol synthase 1, chloroplastic from Soja with 83.21% of identity
• Blastx: Digalactosyldiacylglycerol synthase 1, chloroplastic from Soja with 83.21% of identity
• Eggnog: Digalactosyldiacylglycerol synthase(ENOG410YBC3)
• Kegg: Link to kegg annotations (548059)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429002.1)
• Pfam: Glycosyl transferases group 1 (PF00534.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;