Protein coding transcript 70746

• Transcript: Ll_transcript_483705
• CDS coordinates: 443-1084 (+)
• Peptide sequence: MEPPTSSNAFSFLSKGWREVRDSADADLRLMKDRANEFKNLATSFDRELENFFNSAAPPPPFSVPAMRSNPPQEIEFVKNLQPKLSEIRRAYSSPDFSKKVLEKWKPKARIRIDLSAIRKAIVSEVEEEEEEGDEVVEFERGKRGRKLSLKEFWDWGEWKGESEAPDWEPIRKLKSRFKDLEKNSEFLEKFKSSLVCISVYASISLFSIFISL*
• ORF Type: complete

Annotations of Ll_transcript_483705

• Blastp: Digalactosyldiacylglycerol synthase 1, chloroplastic from Lotus with 73.08% of identity
• Blastx: Digalactosyldiacylglycerol synthase 1, chloroplastic from Lotus with 67.94% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425732.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;