Transcript | Ll_transcript_483709 |
---|---|
CDS coordinates | 3-611 (+) |
Peptide sequence | EMEPNAFSFLSKGWREVRDSADADLRLMKDRANSFKNLATSFDRELENFLNSATPPPFSIPAMGSPPPPEIEFVKKLRPKLSAMRRAYSSPDFSKSVLEKWRPKARIRIDLSAIRNAIVSEVEEAVESDEAVVEFKREKRLSLKEFWDWGEWKGEGEARDWEPIRKLKSRFKEFEKNSEFVEKFKSSLKSMCRHPQESKVCA* |
ORF Type | 5prime_partial |
Blastp | Digalactosyldiacylglycerol synthase 1, chloroplastic from Lotus with 72.17% of identity |
---|---|
Blastx | Digalactosyldiacylglycerol synthase 1, chloroplastic from Lotus with 71.29% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444218.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer