Protein coding transcript 70752

• Transcript: Ll_transcript_483714
• CDS coordinates: 637-1239 (+)
• Peptide sequence: MTGTAVNPLFRAAYLSQSAKQKVTLLIPWLCKSDQELVYPSNVTFTSPEEQEAYIRNWLEERVGFKADFKISFYPGKFSKSRRSILPAGDTSQFIPSRDADIAILEEPEHLNWYHHGKRWTDKFNHVVGIVHTNYLEYIKREKNGALQAFLVKHINNWVTRAYCHKVLRLSASTQDLPKSVICNVHGVNPKFLIIGEKIAA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_483714

• Blastp: Digalactosyldiacylglycerol synthase 1, chloroplastic from Soja with 95.52% of identity
• Blastx: Digalactosyldiacylglycerol synthase 1, chloroplastic from Soja with 91.14% of identity
• Eggnog: Digalactosyldiacylglycerol synthase(ENOG410YBC3)
• Kegg: Link to kegg annotations (548059)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425732.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;