Protein coding transcript 70763

• Transcript: Ll_transcript_483646
• CDS coordinates: 401-766 (+)
• Peptide sequence: MQSFKSKEYVRETFAWMHYYWFLTNDGIEFLRTYLNLPSEIVPATLKKQAKPAGRPFGGPPGDRPRGPPRFDGERRFGGDRDGYRGGPRGPGGDFGGDKGGAPADYRPSFGVTFLHLIFMF*
• ORF Type: complete

Annotations of Ll_transcript_483646

• Blastp: 40S ribosomal protein S10-1 from Arabidopsis with 81.82% of identity
• Blastx: 40S ribosomal protein S10-3 from Arabidopsis with 92.5% of identity
• Eggnog: Ribosomal protein(COG5045)
• Kegg: Link to kegg annotations (AT4G25740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421657.1)
• Pfam: Plectin/S10 domain (PF03501.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;