Transcript | Ll_transcript_483648 |
---|---|
CDS coordinates | 73-615 (+) |
Peptide sequence | MIISEKNRKEISKYLFQEGVLYAKKDFNLAKHPEIDVPNLQVIKLMQSFKSKEYVRETFAWMHYYWFLTNDGIEFLRTYLNLPSEIVPATLKKQAKPAGRPFGGPPGDRPRGPPRFDGERRFGGDRDGYRGGPRAPTGDFGGEKGGAPADYRPSFGGPPGGRSGFGRGAGGYGAPPPSNA* |
ORF Type | complete |
Blastp | 40S ribosomal protein S10-2 from Oryza sativa with 82.05% of identity |
---|---|
Blastx | 40S ribosomal protein S10-3 from Arabidopsis with 89.58% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (4329619) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421657.1) |
Pfam | Plectin/S10 domain (PF03501.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer