Transcript | Ll_transcript_484375 |
---|---|
CDS coordinates | 3-422 (+) |
Peptide sequence | HNLISFCYFLIVINPLNILSGAASGPTNSEQIRAKKNIEKKRNSFRRQSARFKPENVEPTEDSFEIDDAKFVISRLCDDMSEKSDPTTSSLTSGEENNACKSDPWEIRRSSVGRPMRQSVVKIQSYKEVPLNVKMRRPA* |
ORF Type | 5prime_partial |
Blastp | SHUGOSHIN 2 from Arabidopsis with 37.27% of identity |
---|---|
Blastx | SHUGOSHIN 2 from Arabidopsis with 37.27% of identity |
Eggnog | NA(ENOG410YNQ1) |
Kegg | Link to kegg annotations (AT5G04320) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459512.1) |
Pfam | Shugoshin C terminus (PF07557.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer