Protein coding transcript 70817

• Transcript: Ll_transcript_484375
• CDS coordinates: 3-422 (+)
• Peptide sequence: HNLISFCYFLIVINPLNILSGAASGPTNSEQIRAKKNIEKKRNSFRRQSARFKPENVEPTEDSFEIDDAKFVISRLCDDMSEKSDPTTSSLTSGEENNACKSDPWEIRRSSVGRPMRQSVVKIQSYKEVPLNVKMRRPA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_484375

• Blastp: SHUGOSHIN 2 from Arabidopsis with 37.27% of identity
• Blastx: SHUGOSHIN 2 from Arabidopsis with 37.27% of identity
• Eggnog: NA(ENOG410YNQ1)
• Kegg: Link to kegg annotations (AT5G04320)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459512.1)
• Pfam: Shugoshin C terminus (PF07557.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;