Transcript | Ll_transcript_483777 |
---|---|
CDS coordinates | 117-839 (+) |
Peptide sequence | MALASRLFPKSKLVYGSQVLLQKEYAVPVRHFAKESAPPALKGDTMLKNIFVELKNKYETAMGLLKNEKITIDPDDPAAVSHYAKVMKTIREKARLSSESQHIQESIETQTADIPDARTYLLTLKEIRIKSGLVDDRGAEALMIEALDKIEKDLRKPLLRNDKKGMDLLLAEFDKMNKKLGIRKEDLPKYEEKLELSIAKAQLEELKKDALEAIETQSKREEFKDEGTIDVKSLDVRNFI* |
ORF Type | complete |
Blastp | Probable ATP synthase 24 kDa subunit, mitochondrial from Arabidopsis with 65.42% of identity |
---|---|
Blastx | Probable ATP synthase 24 kDa subunit, mitochondrial from Arabidopsis with 65.13% of identity |
Eggnog | ATP synthase 24 kDa subunit(ENOG410Y0FV) |
Kegg | Link to kegg annotations (AT2G21870) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463561.1) |
Pfam | Mitochondrial ATP synthase subunit (PF15704.4) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer