Protein coding transcript 70836

• Transcript: Ll_transcript_483766
• CDS coordinates: 117-575 (+)
• Peptide sequence: MALASRLFPKSKLVYGSQVLLQKEYAVPVRHFAKESAPPALKGDTMLKNIFVELKNKYETAMGLLKNEKITIDPDDPAAVSHYAKVMKTIREKARLSSESQHIQESIETQTADIPDARTYLLTLKEIRIKCVMVYSNFSFLLLDELIAIYLI*
• ORF Type: complete

Annotations of Ll_transcript_483766

• Blastp: Probable ATP synthase 24 kDa subunit, mitochondrial from Arabidopsis with 57.69% of identity
• Blastx: Probable ATP synthase 24 kDa subunit, mitochondrial from Arabidopsis with 76.58% of identity
• Eggnog: ATP synthase 24 kDa subunit(ENOG410Y0FV)
• Kegg: Link to kegg annotations (AT2G21870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463561.1)
• Pfam: Mitochondrial ATP synthase subunit (PF15704.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;