Protein coding transcript 70838

• Transcript: Ll_transcript_483770
• CDS coordinates: 223-945 (+)
• Peptide sequence: MALTSRLFSKSKLVYGSQVLLQKEYAVPVRHFAKESAPPALKGDTMLKNIFVELKNKYETAIGLLKKEKITIDPEDPAAVSHYAKVMKTIREKASLSSESQHIQESIENQTADIPDARTYLLTLKEIRIKSGLLDDLGAEALMIEALEKIEKDLKKPLLRNDKKGMDLLLAEFDKINKKLGIQKENLPKYEEKLELSIAKAQLEELKKDALEAIDTQSKRDEFKDEGTVDVKSLDIRNFI*
• ORF Type: complete

Annotations of Ll_transcript_483770

• Blastp: Probable ATP synthase 24 kDa subunit, mitochondrial from Arabidopsis with 65.83% of identity
• Blastx: Probable ATP synthase 24 kDa subunit, mitochondrial from Arabidopsis with 65.83% of identity
• Eggnog: ATP synthase 24 kDa subunit(ENOG410Y0FV)
• Kegg: Link to kegg annotations (AT2G21870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462523.1)
• Pfam: Mitochondrial ATP synthase subunit (PF15704.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;