Protein coding transcript 70843

• Transcript: Ll_transcript_483776
• CDS coordinates: 866-1198 (+)
• Peptide sequence: MLSLHGVINLYLVPLFVTSCDFGCSGLSPTAFNCSFFSSYFCELCCYILQSWRVADIPKKDKFQYTYFAHKLNSFDTAPKKLLPSDSRLRPDRLALEKGDLSTSGYEKSR*
• ORF Type: complete

Annotations of Ll_transcript_483776

• Blastp: Oxysterol-binding protein-related protein 3B from Arabidopsis with 78.33% of identity
• Blastx: Oxysterol-binding protein-related protein 3B from Arabidopsis with 71.79% of identity
• Eggnog: Oxysterol-binding protein(ENOG410XP9E)
• Kegg: Link to kegg annotations (AT3G09300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450235.1)
• Pfam: Oxysterol-binding protein (PF01237.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;