Protein coding transcript 70844

• Transcript: Ll_transcript_483778
• CDS coordinates: 183-842 (+)
• Peptide sequence: MAPKDPKQVAASASASAASASGGGFFASIASTLSNFGSSMSKSVNGLDEGLEVINPEGGNEDAEEEAKKGRWKQEERDGYWKMMQKYVGSDITSMVTLPVIIFEPMSMLQRMAELMEYSYLLDMADETEDPYMRLVYASSFFISVYYAYQRTWKPFNPILGETYELVNHGGISFISEQVSHHPPMCAGHAENEHFTYDVTSKLKTKFLGNSVDVYPVGR*
• ORF Type: complete

Annotations of Ll_transcript_483778

• Blastp: Oxysterol-binding protein-related protein 3A from Arabidopsis with 82.61% of identity
• Blastx: Oxysterol-binding protein-related protein 3A from Arabidopsis with 84.21% of identity
• Eggnog: Oxysterol-binding protein(ENOG410XP9E)
• Kegg: Link to kegg annotations (AT5G02100)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450235.1)
• Pfam: Oxysterol-binding protein (PF01237.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;