Protein coding transcript 7088

• Transcript: Ll_transcript_321351
• CDS coordinates: 151-1005 (+)
• Peptide sequence: MLRAMSTRNMRNIVNVLLQRTPNPHFHYSPFFHFQNPSSLSTPSSYLYAFSSISLRLFTTNFSHDDSSGERSDEGASTDGWEEEDTAEPKIGDGGDGGGVALQNVPWGQRAHSIAKEVLTHFTKDIELYAFKTTPRGYVYVRLDKITNEYGCPSMEELECYNHEYRKRLDEVGALGEIPDDLGIEVSSPGAERILKVPDDLGRFKGMPMRVCYAENVESNCPEEDGIFLLDSIDRDSEICIWKLADVKENRDPLKKGKPLNRKQKDWRLKLSFNMHRMVTLYLD*
• ORF Type: complete

Annotations of Ll_transcript_321351

• Blastp: Ribosome maturation factor RimP from Leptospira with 33.1% of identity
• Blastx: Ribosome maturation factor RimP from Leptospira with 33.1% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (LA_0941)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459462.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;