Transcript | Ll_transcript_470728 |
---|---|
CDS coordinates | 2-307 (+) |
Peptide sequence | SGGRGTDHFQNILSQARNNAPRAPGGDDDDEEEPAGPSRPSNFSGRAQTLGGDDAPSRIVADPAAPVAGRRPGAAALPRISRTMHLWADGVSIDDGPLFRFD |
ORF Type | internal |
Blastp | UBX domain-containing protein 1 from Aspergillus with 40.62% of identity |
---|---|
Blastx | UBX domain-containing protein 1 from Aspergillus with 47.54% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AN8228.2) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456914.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer