Protein coding transcript 70914

• Transcript: Ll_transcript_485139
• CDS coordinates: 486-1091 (+)
• Peptide sequence: MATTTTDTTQNPNLNDNPPQEENLTITLDPTEPKPDLALSEQPTPATAADNDAAAAESKVSPTTAPISDAQKKKIRAERFGITVQLSEKDKRNSRAERFGTSSTTQGSETSKSEELKRKARAERFGIPSPTTTADEKAKKKTRLARFAPASKAAADPAEEDKRKARALRFSNQSSGSSTQVNSKGNIEPKVVIAGKAGGGD*
• ORF Type: complete

Annotations of Ll_transcript_485139

• Blastp: Protein MODIFIER OF SNC1 11 from Arabidopsis with 61.16% of identity
• Blastx: Protein MODIFIER OF SNC1 11 from Arabidopsis with 57.53% of identity
• Eggnog: NA(ENOG410Y0Z2)
• Kegg: Link to kegg annotations (AT5G02770)
• CantataDB: Link to cantataDB annotations (CNT0001988)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456431.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;