Protein coding transcript 70977

• Transcript: Ll_transcript_484475
• CDS coordinates: 651-1475 (+)
• Peptide sequence: MGKKGSSSWLNAVKRAFRSPTKDSDKRSSRRKEDYDQEEDEEKKREKRWIFRKNHETVSTKQTPTKLKHDVAAATTNASVASRTDHDHKHALAMALATAEAAMATAQAAIEGARLTKPSANNNNHVRDHFAAVVIQTAFRGYLARRALCALKGLVKLQALVRGHNVRKQAKMTLRCMQALVRVQARVLDQRIRSSHDGSRKSTFSDTASVSELRYLQEISDRKSVSREGSSIVDDWDERPHTVEEVKAMLQQRKEAAMKREKSLSQAFSQQVSS*
• ORF Type: complete

Annotations of Ll_transcript_484475

• Blastp: Protein IQ-DOMAIN 14 from Arabidopsis with 35.42% of identity
• Blastx: Protein IQ-DOMAIN 14 from Arabidopsis with 35.42% of identity
• Eggnog: IQ calmodulin-binding motif(ENOG4111DSA)
• Kegg: Link to kegg annotations (AT2G43680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461226.1)
• Pfam: IQ calmodulin-binding motif (PF00612.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;