| Transcript | Ll_transcript_470734 |
|---|---|
| CDS coordinates | 1-324 (+) |
| Peptide sequence | AWHSAGTFDVNSKTGGPFGTIRHQAELAHGANNGLDIAVRLLEPLKEQFPNISYADFYQLAGVVAVEVTGGPEIPFHPGREDKPEPPQEGRLPDATKGCDHLRDVFIK |
| ORF Type | internal |
| Blastp | L-ascorbate peroxidase, cytosolic from Pisum with 88.89% of identity |
|---|---|
| Blastx | L-ascorbate peroxidase, cytosolic from Pisum with 88.89% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_003606510.1) |
| Pfam | Peroxidase (PF00141.22) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer