Protein coding transcript 71078

• Transcript: Ll_transcript_483396
• CDS coordinates: 2-610 (+)
• Peptide sequence: WLDDQPRGSVVFANFGSSTVFEWDQIREIADGLVRSGSRFLLVVKDEKYFNEDDKKIEAGLEEVLGHELVDKVKDKGLVMKEWVYQSGILNHEAIGGFLSHCGWNSIVEAAWNGVPIFGWPQRGDQKMNAEVVKMSGWGTWNKNWGWIGERLVTGEEIGDAIKVLMNNESFKIRASKIKEAARKGRSVGGDCEVTLHKLFKK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_483396

• Blastp: UDP-glycosyltransferase 13 from Mangifera with 52.74% of identity
• Blastx: UDP-glycosyltransferase 13 from Mangifera with 53.33% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435315.1)
• Pfam: UDP-glucoronosyl and UDP-glucosyl transferase (PF00201.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;