Protein coding transcript 71090

• Transcript: Ll_transcript_483414
• CDS coordinates: 130-774 (+)
• Peptide sequence: MRRASSNLVPSLLSRTIAAASSRSAAASSSFPASNHFLQSALYRTSTTTGGSNNHRRFFSSFLRPYTAASVGVAGALITSLAATSVYQEALAKEPPPAEALPNDVVLYQYEACPFCNKVKAYLDYYDIPYKVVEVNPLSKKEIKWSEYQKVPILVVDGDQLNDSSAIIDKLGQKIMPKKKADENVEETKWRQYGFLFCFIFQSNMSLINIKRLK*
• ORF Type: complete

Annotations of Ll_transcript_483414

• Blastp: Prostaglandin E synthase 2 from Danio with 54.17% of identity
• Blastx: Prostaglandin E synthase 2 from Bos with 52.75% of identity
• Eggnog: prostaglandin E synthase(ENOG410XS2X)
• Kegg: Link to kegg annotations (799964)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436750.1)
• Pfam: Glutaredoxin (PF00462.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;