Protein coding transcript 71145

• Transcript: Ll_transcript_484446
• CDS coordinates: 1381-1794 (+)
• Peptide sequence: MVSENNGKPSLEMVMCLHVLAAIYFNLGQYNEAIQVLERSIDIPVLEDGQDHALAKFADCMQLDNTYAMMGQIENSILFNLAGLEIQGQALGETDPRFGEMCRYVAEAHVQALQFNEAEKLCQRAFDIHRETVSCFA*
• ORF Type: complete

Annotations of Ll_transcript_484446

• Blastp: Protein KINESIN LIGHT CHAIN-RELATED 2 from Arabidopsis with 64.58% of identity
• Blastx: Protein KINESIN LIGHT CHAIN-RELATED 2 from Arabidopsis with 57.68% of identity
• Eggnog: repeat-containing protein(COG0457)
• Kegg: Link to kegg annotations (AT3G27960)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434352.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;