Transcript | Ll_transcript_484443 |
---|---|
CDS coordinates | 371-676 (+) |
Peptide sequence | MRSSDQSPSRASLYSYGEESSRIDSELCHLVGDIVDFEITKEVVTENKEGSNPEKDAVSCGNDPTQKGYIPRRVIEGSVKSSIQLQKEEIHQVTRGMMRRL* |
ORF Type | complete |
Blastp | Protein KINESIN LIGHT CHAIN-RELATED 2 from Arabidopsis with 62.26% of identity |
---|---|
Blastx | Protein KINESIN LIGHT CHAIN-RELATED 2 from Arabidopsis with 64.58% of identity |
Eggnog | repeat-containing protein(COG0457) |
Kegg | Link to kegg annotations (AT3G27960) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019434352.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer